Pyramidobacter piscolens: CE91St28_16300
Help
Entry
CE91St28_16300 CDS
T08073
Name
(GenBank) ABC transporter permease
KO
K11085
ATP-binding cassette, subfamily B, bacterial MsbA [EC:
7.5.2.6
]
Organism
ppio
Pyramidobacter piscolens
Pathway
ppio02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
ppio00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
CE91St28_16300
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ppio02000
]
CE91St28_16300
Enzymes [BR:
ppio01000
]
7. Translocases
7.5 Catalysing the translocation of carbohydrates and their derivatives
7.5.2 Linked to the hydrolysis of a nucleoside triphosphate
7.5.2.6 ABC-type lipid A-core oligosaccharide transporter
CE91St28_16300
Transporters [BR:
ppio02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
CE91St28_16300
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
Zeta_toxin
ABC_ATPase
AAA_29
AAA_16
AAA_22
DUF87
AAA_25
AAA
SbcC_Walker_B
DUF6393
RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID:
BDF78836
LinkDB
All DBs
Position
complement(1711799..1713544)
Genome browser
AA seq
581 aa
AA seq
DB search
MKEKGSKPLYRRLLALLLPYRAKLGCAFVCMVGAGLCAAIPAWLMKNVVDGVLIRKDYAM
LNVLVVSLVILFVFKAAFTYGQKYLMGWVGQKVVMDMRVAAYAHLQTLSLKFINDKRVGE
LLSRVTNDANMLQMTVTNVAVDLVVQGVSCAAMLSYCLYLNWKLMLYTLLILPVVVLVLK
SASEILRRVGRHMQQCVAELSAVAEEALSAIRIVRAFATEELELSRFEESNRQNFDVIIQ
GVKVNAALNGAVEVLLIVALALILWLGGRQVLGDVMSPGELIAFLGSLGFLASPINNFTR
AVSQLQFGFAAAERIFSLLDNDDRVVTPPGAVVLKRLRGEVRFESVWFSYEPEQWILKDL
NLTVRPGEKIAVVGATGAGKSTLVDLVQRFYDPQRGTVFIDGYDVRTVDLKSLRTQIGVV
PQDPVLMKGSIAFNIAYGYAAKKGEIEEAAAIAGISEFIDSLPEKYETEVGIRGVTVSGG
QRQRIAIARAIVRNPRIIILDEATSSLDAAVERQIQEAMDRAMEGRTSFVIAHRLSTIIN
ADRILYLENGHIVEEGTHEELLRKNGAYQKLFSFQYGAGRP
NT seq
1746 nt
NT seq
+upstream
nt +downstream
nt
atgaaagagaaaggaagtaagcctctctatcgtcgactgttggcactccttttgccttac
agggcaaaattgggatgcgcttttgtctgtatggtcggcgccgggctctgcgcggcgatc
cctgcctggctgatgaagaacgtcgtcgacggcgtgctgatccgcaaggattacgcgatg
ctgaacgtgctggtcgtctcgctcgtcatactctttgttttcaaggcggcgtttacttac
ggccaaaagtatttgatgggctgggtcgggcaaaaggtcgtcatggatatgcgggtcgcc
gcttacgctcatctgcagactttgtcgctgaagttcatcaacgacaagcgcgtgggcgag
cttttgtcgcgagtcaccaacgacgccaacatgctgcagatgaccgtcacgaacgtggct
gtggatcttgtcgttcaaggcgtctcgtgcgcggcgatgctttcctattgcctctatctg
aactggaagctgatgctctatacgcttttgatcctgccggtcgtcgttctcgtgctgaag
agcgcttcggaaatcctccgcagggttgggcgccatatgcagcagtgtgtcgccgaactt
tctgcggtagccgaggaagcgctttcggcgattcgcatcgtgcgggcttttgcgacggag
gagctggaactttcccgtttcgaagaaagcaaccggcagaattttgacgtcatcattcag
ggcgtcaaggtcaacgcggctctgaacggcgccgtcgaggtcctcctcattgtggcgctc
gctctgatcctctggctgggaggccgccaggtgctgggcgacgtcatgtcgcccggcgaa
ctgatcgcctttctcgggtcgctgggatttctggcctcgccgatcaacaatttcacgcgc
gccgtcagccagctccaattcggtttcgcggcggcggaacggatcttcagccttctcgac
aacgacgaccgggtcgtgacgccgcctggcgcggtcgttttgaagcgcctgcgaggcgaa
gtgcgttttgaaagcgtatggttcagctacgagccggaacagtggatcttgaaagatctg
aatctgacggttcgccccggcgagaaaatcgccgtcgtcggagcgacgggcgccggcaag
tcgacgctcgtcgatctggtgcagcgcttttacgatccgcagaggggaacggttttcatc
gacggatacgacgtcaggaccgtcgatctcaaaagcctgcgcactcagatcggcgtggtg
ccgcaggatccggttctgatgaaaggctccatcgccttcaacattgcctatggatacgcg
gcgaaaaaaggcgagatcgaagaagcggccgctatcgctggcatctccgaatttatcgat
tctctccccgagaaatacgagacggaagtggggatccgcggcgtcaccgtcagcggcggc
cagcgccagaggattgccatcgcgcgggcgatcgtccgcaatccccgcatcatcatcctc
gacgaggccacttcgtcgctcgacgccgccgtggaacggcagatccaggaggcgatggac
cgcgccatggaggggcgcacgtcgtttgtcatcgctcaccgtctttcgacgatcatcaac
gcagatcgcatcctttacctcgagaacgggcatatcgtcgaagaggggactcacgaagag
ctccttcggaaaaacggggcctatcaaaaactcttttcgtttcaatacggagccggccgt
ccatga
DBGET
integrated database retrieval system