Pseudomonas plecoglossicida: RK21_03478 Help Entry RK21_03478        CDS       T03646                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppj  Pseudomonas plecoglossicida Pathway ppj01100   Metabolic pathways ppj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RK21_03478    00074 Mycolic acid biosynthesis     RK21_03478   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RK21_03478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 Fas_alpha_ACP DUF1493 HLH Motif Other DBs NCBI-ProteinID:  AJG14986 UniProt:  A0A099MVM9 LinkDB All DBs Position complement(3659134..3659370) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTLEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAVDYVKAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaggaagtgactctcgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgctgtagactacgtcaaagcccaccaggcctaa

DBGET integrated database retrieval system