Pseudomonas plecoglossicida: RK21_04243 Help Entry RK21_04243        CDS       T03646                                  Name (GenBank) Phenol hydroxylase P4 protein   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism ppj  Pseudomonas plecoglossicida Pathway ppj00361   Chlorocyclohexane and chlorobenzene degradation ppj00362   Benzoate degradation ppj00623   Toluene degradation ppj01100   Metabolic pathways ppj01120   Microbial metabolism in diverse environments ppj01220   Degradation of aromatic compounds Module ppj_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:ppj00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     RK21_04243    00361 Chlorocyclohexane and chlorobenzene degradation     RK21_04243    00623 Toluene degradation     RK21_04243 Enzymes [BR:ppj01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      RK21_04243     1.14.13.244  phenol 2-monooxygenase (NADH)      RK21_04243 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AJG15751 LinkDB All DBs Position complement(4437709..4438068) Genome browser AA seq 119 aa AA seqDB search MTVNSIGEYTATPRDVQANFNGMQLLYLYWEEHLMYCSALAFLVAPGMPFAEFLEQVLKP AIHAHPDSAKIDFSQALWQLNDQPFTPDYAASLEANGIDHKSMLRLNTPGLNGIQGSCS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgactgtcaactcaatcggcgaatacactgccacgccacgggatgtgcaggccaacttc aacggcatgcaactgctctacctctactgggaagagcacctgatgtactgctccgcgctc gcgttcttggtagcccccggcatgccctttgccgagttcctcgagcaggtgctcaagccc gcgatccacgcccatccggacagcgcgaagatcgatttcagccaggcgctctggcagctg aacgaccagccgttcaccccggactacgccgccagcctggaagccaacggcatcgaccac aaaagcatgctgcgtctgaacaccccgggcctgaacggcatccagggttcctgcagctga

DBGET integrated database retrieval system