Pandoraea pnomenusa 3kgm: U875_12570 Help Entry U875_12570        CDS       T02936                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppk  Pandoraea pnomenusa 3kgm Brite KEGG Orthology (KO) [BR:ppk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppk03032]     U875_12570    03036 Chromosome and associated proteins [BR:ppk03036]     U875_12570    03400 DNA repair and recombination proteins [BR:ppk03400]     U875_12570 DNA replication proteins [BR:ppk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     U875_12570 Chromosome and associated proteins [BR:ppk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     U875_12570 DNA repair and recombination proteins [BR:ppk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       U875_12570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AHB06104 LinkDB All DBs Position 2754402..2754680 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGATGASKAQTGETIDTLIEVIKKAVAKGDTVQLIGFGSFGSGKRAARTG RNPKTGEAIKIPAAKTVKFTAGKAFKDAVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccggcgctacgggtgccagcaaggctcaa accggcgagaccatcgatacgctgatcgaggttatcaagaaagccgtcgccaagggtgat acggttcagttgatcggcttcggctcgttcggttcgggcaagcgtgccgcgcgtaccggc cgcaacccgaagaccggcgaagcgatcaagatcccggccgccaagaccgtgaagttcacg gctggcaaggcgttcaaggacgctgtgaacaagaagtaa

DBGET integrated database retrieval system