Postia placenta: POSPLDRAFT_42439 Help Entry POSPLDRAFT_42439  CDS       T01162                                  Name (GenBank) predicted protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism ppl  Postia placenta Pathway ppl03020   RNA polymerase ppl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ppl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     POSPLDRAFT_42439   09124 Replication and repair    03420 Nucleotide excision repair     POSPLDRAFT_42439  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ppl03021]     POSPLDRAFT_42439    03400 DNA repair and recombination proteins [BR:ppl03400]     POSPLDRAFT_42439 Transcription machinery [BR:ppl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      POSPLDRAFT_42439 DNA repair and recombination proteins [BR:ppl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       POSPLDRAFT_42439 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-ProteinID:  EED83148 JGI:  42439 LinkDB All DBs AA seq 89 aa AA seqDB search IIEDTKIPNAATIKVLKQDHTLGNLIRAYTTVVDAANFVCRYKVPHPLQPHFLIKIQTDG TITPTAVLEQACTKLIGTMASLEAKFKRE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt attatcgaagacacaaagataccgaatgcagccacaatcaaagtcctgaagcaggaccat acccttggcaacctaattcgcgcgtacacaactgttgtcgatgccgcaaattttgtttgc cggtacaaggtcccacacccgctgcagccacacttcctgatcaagattcagacagacggc accatcacgccgactgctgtcctagagcaagcttgcacaaagctcattggtaccatggcg tctctcgaggcgaaattcaagcgggag

DBGET integrated database retrieval system