Postia placenta: POSPLDRAFT_42718 Help Entry POSPLDRAFT_42718  CDS       T01162                                  Name (GenBank) predicted protein   KO K00030   isocitrate dehydrogenase (NAD+) [EC:1.1.1.41] Organism ppl  Postia placenta Pathway ppl00020   Citrate cycle (TCA cycle) ppl01100   Metabolic pathways ppl01110   Biosynthesis of secondary metabolites ppl01200   Carbon metabolism ppl01210   2-Oxocarboxylic acid metabolism ppl01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:ppl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     POSPLDRAFT_42718 Enzymes [BR:ppl01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.41  isocitrate dehydrogenase (NAD+)      POSPLDRAFT_42718 SSDB OrthologParalogGFIT Motif Pfam:  Iso_dh Motif Other DBs NCBI-ProteinID:  EED84714 JGI:  42718 LinkDB All DBs AA seq 83 aa AA seqDB search QPTKYGGVYTVTLIPGDGIGNEITDSVKEIFEYVNAPIEWEQYNVSGMSSAGEDLFKQAV ESLRRNRVGLKGILFTPISQSGH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt caaccgaccaagtatggcggtgtctacactgttaccctcatcccgggtgatggtatcggt aacgagattacggactccgtgaaggagatcttcgagtatgtcaacgcccccattgagtgg gagcagtacaacgtctccggaatgtcgtccgccggcgaggatctcttcaagcaggctgtg gagagcttgaggcgcaaccgggtcggtctcaagggtatccttttcacccccatctcccag tccggtcac

DBGET integrated database retrieval system