Planococcus plakortidis: BBI15_04745 Help Entry BBI15_04745       CDS       T04812                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppla  Planococcus plakortidis Brite KEGG Orthology (KO) [BR:ppla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppla03032]     BBI15_04745    03036 Chromosome and associated proteins [BR:ppla03036]     BBI15_04745    03400 DNA repair and recombination proteins [BR:ppla03400]     BBI15_04745 DNA replication proteins [BR:ppla03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BBI15_04745 Chromosome and associated proteins [BR:ppla03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BBI15_04745 DNA repair and recombination proteins [BR:ppla03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BBI15_04745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 Rpf1_C SIS_2 Motif Other DBs NCBI-ProteinID:  ANU19558 UniProt:  A0A1C7E764 LinkDB All DBs Position complement(1827689..1827961) Genome browser AA seq 90 aa AA seqDB search MNKTELVNSVAEAAELSRKDAAKAVDAAFEAIQDALTKGEKVQLIGFGNFEVRERAARKG RNPQTGAEIEIAASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattagtgaactctgttgcagaagcggctgaactttctcgtaaagat gctgcgaaagcagttgacgctgcatttgaggcgattcaagatgctctaactaaaggtgaa aaagtacaattgatcggattcggtaactttgaagttcgtgagcgcgcggcccgtaaagga cgcaacccacagacaggtgctgaaatcgagattgccgctagcaaggttcctgcctttaag ccaggtaaagcacttaaagacgcagtgaaataa

DBGET integrated database retrieval system