KEGG   Planococcus plakortidis: BBI15_05170
Entry
BBI15_05170       CDS       T04812                                 
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
ppla  Planococcus plakortidis
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppla03016]
    BBI15_05170
Enzymes [BR:ppla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BBI15_05170
Transfer RNA biogenesis [BR:ppla03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    BBI15_05170
 Prokaryotic type
    BBI15_05170
SSDB
Motif
Pfam: TruB_N TruB_C_2
Other DBs
NCBI-ProteinID: ANU19637
UniProt: A0A1C7E857
LinkDB
Position
complement(1913657..1914586)
AA seq 309 aa
MEPNGILPLWKEPGMTSHDCVFRLRKILRTKKVGHTGTLDPQVDGVLPICLGRSTKVAEY
ITDQGKTYEAEVLIGASTETEDAEGAVVEQDLSDKMITRKQLEEVLQSLTGDIEQIPPMY
SAVKVNGRKLYEYARKGESVERPVRTVHIDSIELLDEADTWEGQNIRFRIRIRCGKGTYI
RTLAVQIGEALGYPAHMSQLTRTQSGSFTKEQCVTLAEVEEIAQNGDIGSILQPLAYGLS
AFPFEEITPDLLFGIKNGQVLEAHPVLKTEPFVVFTYHGKPAALYKRHPEKPGKMKPEKM
FGFPPTDEV
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagccgaatgggatccttccattatggaaagaaccgggcatgacatcgcatgattgc
gtttttcgcctgagaaaaatcctgagaacaaaaaaagtcgggcataccggaacactcgat
ccgcaagtggacggcgtgttgccgatttgtttgggacggtcgaccaaggtggcagaatat
atcacggatcaagggaaaacttacgaagcggaagtgttgatcggagcttcaacggaaaca
gaagatgcagaaggcgcggtagtggaacaagacctgagcgacaaaatgattacacgcaag
cagctagaagaggtattgcaaagcctgaccggcgacattgaacaaatcccgccgatgtat
tcagcggtcaaagtgaacggcagaaagctgtatgaatatgcgcgcaaaggcgaatcagtg
gagcgccctgtacgcacggtgcatattgattctatcgaattattggatgaggcggacaca
tgggaagggcagaatattcgtttccgcatccgcatccgctgcggcaaagggacctatatc
cgaacacttgccgtccagatcggcgaagcgcttggatatccggcccatatgtcacagctg
acgcgcacacagtccggcagttttacgaaagaacaatgtgtgacgcttgccgaagtggag
gaaattgcgcaaaatggggatatcggttctattttgcagcctctcgcatacggcttaagt
gcatttccttttgaagaaatcacgccggatctactgttcggcatcaaaaatggccaagtg
ctcgaggcgcatccggtcttgaagacagaaccgtttgtcgttttcacttatcatggcaaa
ccggcagcattgtacaaacggcatcccgagaagccgggtaaaatgaaacccgaaaaaatg
tttggatttcctccaacggacgaggtgtag

DBGET integrated database retrieval system