Pleuronectes platessa (European plaice): 128425703 Help Entry 128425703         CDS       T09923                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04137   Mitophagy - animal pplt04140   Autophagy - animal pplt04144   Endocytosis pplt04145   Phagosome pplt04148   Efferocytosis pplt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pplt00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128425703    04145 Phagosome     128425703    04140 Autophagy - animal     128425703    04137 Mitophagy - animal     128425703    04148 Efferocytosis     128425703  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128425703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pplt04131]     128425703   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pplt04147]     128425703    04031 GTP-binding proteins [BR:pplt04031]     128425703 Membrane trafficking [BR:pplt04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     128425703 Exosome [BR:pplt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128425703   Exosomal proteins of other body fluids (saliva and urine)    128425703   Exosomal proteins of colorectal cancer cells    128425703   Exosomal proteins of bladder cancer cells    128425703 GTP-binding proteins [BR:pplt04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     128425703 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  128425703 NCBI-ProteinID:  XP_053268418 LinkDB All DBs Position 2:22168759..22175655 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtcaaggaagaaagttctactcaaagtcatcatcctgggagactccggagttgga aagacctcattgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggagctgatttcctcacaaaagaagtcatggttgatgacagacttgtcacaatgcag atctgggacacagcaggtcaggagaggttccagtccttaggtgttgcgttctaccgtgga gccgactgctgcgtcctggtgtttgacgtgacggcacccaacaccttcaagacccttgac agctggagggacgagttcttgattcaggccagccctcgagaccctgagaacttccccttt gtggtgctgggcaacaagattgacttggagaacagacaggtaacaaccaagagggcacaa gcttggtgtcagagcaagaacaacatcccatatttcgaaaccagcgccaaggaggcaatc aatgtggaacaggccttccagactattgcacgcaacgctcttaaacaggaaaccgaggtt gagctgtacaacgagttcccagagccaatcaagctggacaggaacgagcgagccaagccg tcggcagagacctgcagctgctga

DBGET integrated database retrieval system