Pleuronectes platessa (European plaice): 128436695 Help Entry 128436695         CDS       T09923                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt03030   DNA replication pplt03410   Base excision repair pplt03420   Nucleotide excision repair pplt03430   Mismatch repair pplt03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pplt00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     128436695 (pold4)    03410 Base excision repair     128436695 (pold4)    03420 Nucleotide excision repair     128436695 (pold4)    03430 Mismatch repair     128436695 (pold4)    03440 Homologous recombination     128436695 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pplt03032]     128436695 (pold4)    03400 DNA repair and recombination proteins [BR:pplt03400]     128436695 (pold4) DNA replication proteins [BR:pplt03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     128436695 (pold4) DNA repair and recombination proteins [BR:pplt03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       128436695 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      128436695 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Phage_cap_E Motif Other DBs NCBI-GeneID:  128436695 NCBI-ProteinID:  XP_053274481 LinkDB All DBs Position 3:complement(29077656..29080660) Genome browser AA seq 108 aa AA seqDB search MTTKRGLITDSFKVVKRARRASKRVKRAIPPPPQKEADTVTVRDNELQKLRQFDLDSKFG PCTGIGRLQRWERAQFHGLNPPEEIRDLLLQTHTDPEYSQSLWSEYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaagcgtggactgataacggactcattcaaggtggtaaagagagcaaggagg gcgagcaaacgagtgaagagagccattcctcccccaccacagaaagaggctgacactgta acagtcagagataatgagctgcagaagctcagacagtttgatctggactcgaagtttggg ccctgcacaggtatcggcaggctgcagagatgggagagagcacagttccatggtctgaat ccacctgaggagatcagagacctgctgctgcagacacacactgaccccgaatattcccag agcctatggagtgaatatcctttgtaa

DBGET integrated database retrieval system