Pleuronectes platessa (European plaice): 128437174 Help Entry 128437174         CDS       T09923                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pplt  Pleuronectes platessa (European plaice) Brite KEGG Orthology (KO) [BR:pplt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pplt03041]     128437174 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pplt04052]     128437174 (ubl5) Spliceosome [BR:pplt03041]  Complex B   Other components    Complex B specific factors     128437174 (ubl5) Cytokines and neuropeptides [BR:pplt04052]  Neuropeptides   Unclassified    128437174 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler DUF5343 OTU1_UBXL Motif Other DBs NCBI-GeneID:  128437174 NCBI-ProteinID:  XP_053275198 LinkDB All DBs Position 3:6172189..6174377 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRHDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtctgcaacgatcgtctgggcaagaaagtccgggtcaagtgcaactct gaagataccatcggagatctgaagaagctcattgctgcccagacaggaacacggcacgac aagattgttttaaagaaatggtataccatattcaaggatcacgtgtctctgggcgactat gaaattcatgatgggatgaacctggagctgtactaccagtag

DBGET integrated database retrieval system