Pleuronectes platessa (European plaice): 128444413 Help Entry 128444413         CDS       T09923                                  Symbol mt2 Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism pplt  Pleuronectes platessa (European plaice) Brite KEGG Orthology (KO) [BR:pplt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pplt03019]     128444413 (mt2)    03029 Mitochondrial biogenesis [BR:pplt03029]     128444413 (mt2) Messenger RNA biogenesis [BR:pplt03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      128444413 (mt2) Mitochondrial biogenesis [BR:pplt03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     128444413 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  128444413 NCBI-ProteinID:  XP_053282867 LinkDB All DBs Position 7:4971592..4972526 Genome browser AA seq 60 aa AA seqDB search MDPCECSKTGTCNCGGSCTCKNCSCTTCNKSCCPCCPSGCPKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgaatgctccaagactggaacctgcaactgcggaggatcttgcacctgc aagaactgcagctgcaccacctgcaacaagagctgctgcccatgctgcccatccggctgc cccaagtgcgcctctggctgcgtgtgcaaagggaagacatgcgacaccagctgctgtcag tga

DBGET integrated database retrieval system