Pleuronectes platessa (European plaice): 128449542 Help Entry 128449542         CDS       T09923                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04010   MAPK signaling pathway pplt04144   Endocytosis pplt04370   VEGF signaling pathway pplt04510   Focal adhesion pplt04517   IgSF CAM signaling pplt04518   Integrin signaling pplt04519   Cadherin signaling pplt04520   Adherens junction pplt04530   Tight junction pplt04810   Regulation of actin cytoskeleton pplt04912   GnRH signaling pathway pplt05100   Bacterial invasion of epithelial cells pplt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pplt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128449542 (cdc42l)    04370 VEGF signaling pathway     128449542 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     128449542 (cdc42l)    04518 Integrin signaling     128449542 (cdc42l)    04519 Cadherin signaling     128449542 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128449542 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128449542 (cdc42l)    04520 Adherens junction     128449542 (cdc42l)    04530 Tight junction     128449542 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128449542 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     128449542 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128449542 (cdc42l)    05100 Bacterial invasion of epithelial cells     128449542 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pplt04131]     128449542 (cdc42l)    03036 Chromosome and associated proteins [BR:pplt03036]     128449542 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pplt04147]     128449542 (cdc42l)    04031 GTP-binding proteins [BR:pplt04031]     128449542 (cdc42l) Membrane trafficking [BR:pplt04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     128449542 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     128449542 (cdc42l)   Macropinocytosis    Ras GTPases     128449542 (cdc42l) Chromosome and associated proteins [BR:pplt03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     128449542 (cdc42l) Exosome [BR:pplt04147]  Exosomal proteins   Exosomal proteins of microglial cells    128449542 (cdc42l)   Exosomal proteins of breast milk    128449542 (cdc42l) GTP-binding proteins [BR:pplt04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     128449542 (cdc42l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DM7 Motif Other DBs NCBI-GeneID:  128449542 NCBI-ProteinID:  XP_053288746 LinkDB All DBs Position 10:9433014..9437562 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQMDLR EDSNTIEKLAKNKQRPLYPEMGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggagacggtgcagtaggaaagacctgcctactg atctcctacacaaccaacaagttcccctcagaatatgtgcccacggtttttgataattat gctgtgacggtgatgattgggggggagccctatacactcggcctttttgacacagcaggt caggaggattatgacaggctgcgtcctctcagttacccacagacagacgtgttcctcgta tgtttctctgtcgtctccccctcatcttttgaaaatgtcaaagaaaagtgggttcctgag atttctcaccactgcccacgcacacccttcctgttagtgggcacacagatggacctgcgg gaagacagcaacacaattgagaagctggcaaagaacaaacagcggcccctctatcctgag atgggagagaagctggcacgtgagctcaaggccgtcaaatacgtggagtgctctgctctg acacagcgagggcttaagaatgtgtttgacgaggcgatcctggcagcattggagcctcca gagaccaaaaccaagagaaagtgcattctcctatag

DBGET integrated database retrieval system