Pleuronectes platessa (European plaice): 128454236 Help Entry 128454236         CDS       T09923                                  Symbol ccl25a Name (RefSeq) C-C motif chemokine 21b   KO K13072   C-C motif chemokine 25 Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04060   Cytokine-cytokine receptor interaction pplt04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:pplt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128454236 (ccl25a)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     128454236 (ccl25a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pplt04052]     128454236 (ccl25a) Cytokines and neuropeptides [BR:pplt04052]  Cytokines   Chemokines    128454236 (ccl25a) SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  128454236 NCBI-ProteinID:  XP_053293517 LinkDB All DBs Position 13:5935375..5937846 Genome browser AA seq 105 aa AA seqDB search MRFYVMILLLGLSCVCLTLAQVSYEDCCLRYVKSISQRHAVGYRVQEQDGGCNIPAVIFI MKRGRVFCTNPKDPWVQTLMDKIDQRGRNAKRPGRRPYRLQKNRG NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcggttctacgtgatgatcctcctgctgggactgtcctgtgtctgtctcacgctggca caagtgtcctatgaagactgctgtctgaggtatgtgaaaagcataagccagagacatgca gtgggttacagagtgcaggagcaggacggcggctgcaacatcccggctgtgatcttcatc atgaagagggggcgtgtgttttgcaccaaccccaaagatccatgggtccagactctgatg gataagatcgaccaaaggggaagaaatgctaaaagacccgggagacggccctatcgactg cagaagaacagaggctga

DBGET integrated database retrieval system