Pleuronectes platessa (European plaice): 128454836 Help Entry 128454836         CDS       T09923                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04137   Mitophagy - animal pplt04140   Autophagy - animal pplt04144   Endocytosis pplt04145   Phagosome pplt04148   Efferocytosis pplt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pplt00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128454836    04145 Phagosome     128454836    04140 Autophagy - animal     128454836    04137 Mitophagy - animal     128454836    04148 Efferocytosis     128454836  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128454836  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pplt04131]     128454836   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pplt04147]     128454836    04031 GTP-binding proteins [BR:pplt04031]     128454836 Membrane trafficking [BR:pplt04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     128454836 Exosome [BR:pplt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128454836   Exosomal proteins of other body fluids (saliva and urine)    128454836   Exosomal proteins of colorectal cancer cells    128454836   Exosomal proteins of bladder cancer cells    128454836 GTP-binding proteins [BR:pplt04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     128454836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  128454836 NCBI-ProteinID:  XP_053294377 LinkDB All DBs Position 2:complement(15400752..15408999) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAEICSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcctgaaagtcatcatcctgggagattctggtgttgga aagacctccctcatgaaccagtacgtgaacaagaagttcagtaaccagtacaaagctaca ataggagcagacttcctgacgaaagaggtgatggtggatgaccggctcgttacaatgcag atatgggacacagctggccaggagaggttccagtccttgggtgttgcgttctaccgtggc gcagactgctgcgttctggtgttcgatgtgactgcacccaatacgttcaagaccctcgac agctggagggatgagttcctgatccaggccagccccagggacccggagaacttccccttt gtggttctaggcaacaagatcgacctggagaatagacaggtaaccaccaaaagagctcag gcttggtgtcagagtaagaacaacatcccctactttgagacaagtgccaaagaagccata aatgtagaacaggcattccagacaattgcacgtaatgccctcaaacaggagacagaagtg gagctgtataatgaattcccagagcccataaaactggataggaacgacagagctaaacct tctgcagaaatctgcagctgctaa

DBGET integrated database retrieval system