Pleuronectes platessa (European plaice): 128455982 Help Entry 128455982         CDS       T09923                                  Symbol brk1 Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04810   Regulation of actin cytoskeleton pplt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pplt00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     128455982 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128455982 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd SPX DUF7310 Matrilin_ccoil Motif Other DBs NCBI-GeneID:  128455982 NCBI-ProteinID:  XP_053295955 LinkDB All DBs Position 2:complement(12574534..12575929) Genome browser AA seq 86 aa AA seqDB search MNATPYRDSSNMAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLAT LNEKLTALERRIEYIEARVTKGETLT NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgctacgccgtatcgcgactcgtccaacatggccggccaggaggatccagtgcag agagagattcaccaggactgggccaaccgagagtacatagaagtgatcacgagcagtatc aaaaaaatcgccgactttctgaattccttcgatatgtcgtgtcgctcccgtctggccact ctcaatgagaagctgacagcgctggagcggaggattgaatacattgaggcgagagtgaca aaaggagagactttgacctag

DBGET integrated database retrieval system