Pleuronectes platessa (European plaice): 128456805 Help Entry 128456805         CDS       T09923                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04010   MAPK signaling pathway pplt04068   FoxO signaling pathway pplt04081   Hormone signaling pplt04114   Oocyte meiosis pplt04140   Autophagy - animal pplt04150   mTOR signaling pathway pplt04810   Regulation of actin cytoskeleton pplt04910   Insulin signaling pathway pplt04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pplt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128456805 (ins)    04068 FoxO signaling pathway     128456805 (ins)    04150 mTOR signaling pathway     128456805 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     128456805 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128456805 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     128456805 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128456805 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     128456805 (ins)    04914 Progesterone-mediated oocyte maturation     128456805 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pplt04052]     128456805 (ins) Cytokines and neuropeptides [BR:pplt04052]  Neuropeptides   Unclassified    128456805 (ins) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  128456805 NCBI-ProteinID:  XP_053297147 LinkDB All DBs Position 15:959124..959577 Genome browser AA seq 115 aa AA seqDB search MAALWLQSVSLLVLMLVSWSGSQAVLPPQHLCGAHLVDALYLVCGERGFFYTPKRDVDSL LGFLPPKSGGAAAGGDNEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcggctctgtggctccagtctgtgtctctgctcgtcctgatgctcgtgtcctggtcg ggctcccaggccgtgctccccccgcagcacctctgtggcgctcacctggtcgacgccctc tacctggtgtgtggcgagagaggcttcttctacacccccaagagagacgtggactctctg ctgggtttccttcctccgaaatcgggcggagccgcagcgggcggagacaacgaggtggcc gagttcgccttcaaggaccagatggagatgatggtgaagcgcggcatcgtggagcagtgc tgccacaagccctgcaacatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system