Pleuronectes platessa (European plaice): 128456924 Help Entry 128456924         CDS       T09923                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04814   Motor proteins pplt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pplt00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     128456924 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128456924 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pplt03037]     128456924 (dynll2b)    04812 Cytoskeleton proteins [BR:pplt04812]     128456924 (dynll2b) Cilium and associated proteins [BR:pplt03037]  Motile cilia and associated proteins   Dynein arm    128456924 (dynll2b) Cytoskeleton proteins [BR:pplt04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      128456924 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light RP853 Nop Motif Other DBs NCBI-GeneID:  128456924 NCBI-ProteinID:  XP_053297333 LinkDB All DBs Position 15:11919085..11921093 Genome browser AA seq 89 aa AA seqDB search MSDKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagaaggcagtgataaagaatgcagacatgtctgatgaaatgcagcaggat gctgtggactgtgccatgcaggccatggagaagtacaacattgagaaggatattgccgct tatgtcaaaaaggagtttgacaagaagtacaaccccacctggcattgcatcgtcgggagg aactttggtagctatgtgacacacgagacgaagcatttcatctacttctacctgggccaa gtggctattctactcttcaagtcgggctga

DBGET integrated database retrieval system