Pleuronectes platessa (European plaice): 128461967 Help Entry 128461967         CDS       T09923                                  Symbol npy Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04080   Neuroactive ligand-receptor interaction pplt04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:pplt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     128461967 (npy)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     128461967 (npy)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pplt04052]     128461967 (npy) Cytokines and neuropeptides [BR:pplt04052]  Neuropeptides   GPCR binding    128461967 (npy) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  128461967 NCBI-ProteinID:  XP_053303145 LinkDB All DBs Position 18:11072641..11074664 Genome browser AA seq 99 aa AA seqDB search MNPNLVSWLGTLGLLLWALLCLSALTEGYPMKPENPGEDAPAEDLAKYYSALRHYINLIT RQRYGKRSSPEILDTLVSELLLKESTDTLPQSRYDPSLW NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaatcctaacttggtgagctggctggggactctggggctccttctgtgggcgctgctc tgcctgagcgccctgaccgagggatacccgatgaaaccggagaaccccggggaggacgcc ccggcggaggatctggcgaaatactactcagccctgagacactacatcaacctcatcacg agacagaggtatgggaagaggtccagtcctgagattctggacacgctggtctcggagctg ctgctgaaggaaagcacagacacgcttccacagtcaagatatgacccatcattgtggtga

DBGET integrated database retrieval system