Pleuronectes platessa (European plaice): 128462134 Help Entry 128462134         CDS       T09923                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism pplt  Pleuronectes platessa (European plaice) Pathway pplt04382   Cornified envelope formation pplt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pplt00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128462134 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128462134 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pplt04147]     128462134 (s100a10a) Exosome [BR:pplt04147]  Exosomal proteins   Exosomal proteins of microglial cells    128462134 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg NNH2 EH DUF7078 Motif Other DBs NCBI-GeneID:  128462134 NCBI-ProteinID:  XP_053303400 LinkDB All DBs Position 18:17236017..17237732 Genome browser AA seq 100 aa AA seqDB search MPSELETAMESLIKVFHRYASKEKNTTTLNRRELRELMENELSNFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQSHMCKKTKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttccgaactggaaaccgcgatggagtcactcatcaaagtgttccaccgttacgcc tcaaaggaaaaaaacaccaccacactgaaccggcgagagctcagagagttgatggaaaac gagctgtccaacttcctcaagagtcagaaggacccggctgccgtcgacaagatcatgaag gacctggacaccaacggagacggccaggtggactttgaggagtttgtgtctctggttgtc ggactttccatcgcctgtgagcagtgctaccagtcgcacatgtgcaagaagaccaagaag taa

DBGET integrated database retrieval system