Pandoraea pnomenusa DSM 16536: LV28_01295 Help Entry LV28_01295        CDS       T03411                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ppnm  Pandoraea pnomenusa DSM 16536 Brite KEGG Orthology (KO) [BR:ppnm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ppnm03032]     LV28_01295    03036 Chromosome and associated proteins [BR:ppnm03036]     LV28_01295    03400 DNA repair and recombination proteins [BR:ppnm03400]     LV28_01295 DNA replication proteins [BR:ppnm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LV28_01295 Chromosome and associated proteins [BR:ppnm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LV28_01295 DNA repair and recombination proteins [BR:ppnm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LV28_01295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AIU25379 UniProt:  A0A378YB76 LinkDB All DBs Position 2892311..2892589 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGATGASKAQTGETIDTLIEVIKKAVAKGDTVQLIGFGSFGSGKRAARTG RNPKTGEAIKIPAAKTVKFTAGKAFKDAVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccggcgctacgggtgccagcaaggctcaa accggcgagaccatcgatacgctaatcgaggttatcaagaaagccgtcgccaagggtgat acggttcagttgatcggcttcggctcgttcggttcgggcaagcgtgccgcgcgtaccggc cgcaacccgaagaccggcgaagcgatcaagatcccggccgccaagaccgtgaagttcacg gctggcaaggcgttcaaggacgctgtgaacaagaagtaa

DBGET integrated database retrieval system