Pandoraea pnomenusa DSM 16536: LV28_09860 Help Entry LV28_09860        CDS       T03411                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppnm  Pandoraea pnomenusa DSM 16536 Pathway ppnm00998   Biosynthesis of various antibiotics ppnm01100   Metabolic pathways ppnm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppnm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LV28_09860    00074 Mycolic acid biosynthesis     LV28_09860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LV28_09860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AIU26807 UniProt:  A0A378YJQ8 LinkDB All DBs Position 999509..999748 Genome browser AA seq 79 aa AA seqDB search MANFEERVKKIVAEQLGVAEADVKNDSNFVTDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQQAIDYVTANSAK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggctaactttgaagaacgcgtcaagaagatcgtcgcggaacaacttggcgtggcggaa gccgacgtcaagaacgattcgaactttgtgaccgatcttggcgccgattcgctcgacacg gttgagctggtgatggccctcgaagaagaattcgaaacggaaattccggacgaagaagcc gagaagatcaccaccgtgcaacaggctatcgattacgtgacggctaactcggccaagtaa

DBGET integrated database retrieval system