Pandoraea pnomenusa DSM 16536: LV28_13450 Help Entry LV28_13450        CDS       T03411                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppnm  Pandoraea pnomenusa DSM 16536 Pathway ppnm00998   Biosynthesis of various antibiotics ppnm01100   Metabolic pathways ppnm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppnm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LV28_13450    00074 Mycolic acid biosynthesis     LV28_13450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LV28_13450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  AIU27401 UniProt:  A0A378YQ29 LinkDB All DBs Position complement(232520..232741) Genome browser AA seq 73 aa AA seqDB search MEKFYAELAEVLEIDPATVGPDMALADHNWDSLAIVSTIAIVDEIFNVTLDGSALGKCEK VSDIEALIEKAKA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtggaaaaattttacgccgaactcgcagaagtgctggaaatcgatcccgcgaccgtaggc ccggatatggcgctggcagaccacaactgggattcgctggcgatcgtctcgaccattgcc atcgtcgacgagatcttcaatgtgacgctcgacggctcggccctgggcaaatgtgaaaag gtctcggatatcgaggcgctgattgaaaaggccaaggcatga

DBGET integrated database retrieval system