Pandoraea pnomenusa RB38: DA70_13895 Help Entry DA70_13895        CDS       T03067                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism ppno  Pandoraea pnomenusa RB38 Brite KEGG Orthology (KO) [BR:ppno00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppno03110]     DA70_13895 Chaperones and folding catalysts [BR:ppno03110]  Protein folding catalysts   Protein disulfide isomerase    DA70_13895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  AHN75437 UniProt:  A0A378YR55 LinkDB All DBs Position 510902..511162 Genome browser AA seq 86 aa AA seqDB search MPKIVMYSTQVCPYCQMAERLLRQRGVQEIEKILIDKEPARREEMMTRTGRRTVPQIYID ERHIGGYDDLSALDRAGGLVPLLQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgccgaagatcgtgatgtacagcacgcaagtgtgtccctactgccagatggcggaacgt ctgctgcgccagcgtggcgtccaggaaatcgagaagatcctgatcgacaaggaacccgcc cgccgcgaggaaatgatgacgcgcacggggcgccgcaccgtgccgcaaatctacatcgac gaacgccacattggcggttacgacgatctttcggcgctggatcgtgccggcggcctggtg ccgctcttgcaagcggcctga

DBGET integrated database retrieval system