Paenibacillus polymyxa M1: PPM_0142 Help Entry PPM_0142          CDS       T01968                                  Symbol M1-298 Name (GenBank) hypothetical protein   KO K06317   inhibitor of the pro-sigma K processing machinery Organism ppo  Paenibacillus polymyxa M1 Brite KEGG Orthology (KO) [BR:ppo00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     PPM_0142 (M1-298) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BofA Motif Other DBs NCBI-ProteinID:  CCC83079 LinkDB All DBs Position 179427..179702 Genome browser AA seq 91 aa AA seqDB search MRGVVWLVLIACAGILMYLILKKHLGIGWFVVFGAHMALAAIALYVINYSGWITQVYIPI NPVTMGAVTILGLPGIALLLGLKIILFGQAV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagaggggtagtctggcttgttttgattgcttgtgccggaatactgatgtatctaatc ctcaaaaaacatctggggatcggttggtttgtagtattcggagcgcatatggctctggca gctattgcactgtatgttatcaattattcaggatggattacacaggtgtacattccgatt aacccagtgacgatgggggcagtaacgatattaggcttgccaggcattgcgcttttactg ggattgaaaataatattgttcggacaggctgtgtga

DBGET integrated database retrieval system