Pectobacterium polaris: BJK05_07810 Help Entry BJK05_07810       CDS       T05195                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppoa  Pectobacterium polaris Pathway ppoa00998   Biosynthesis of various antibiotics ppoa01100   Metabolic pathways ppoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJK05_07810    00074 Mycolic acid biosynthesis     BJK05_07810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJK05_07810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  ASY79905 LinkDB All DBs Position complement(1807505..1807741) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagcttggtgttaagcag gaagaagtcgtaaacaatgcttctttcgttgacgacctcggcgctgattctcttgacact gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagct gaaaaaatcacgactgttcaagcagccattgatttcattcaggctaaccagcagtaa

DBGET integrated database retrieval system