Pectobacterium polaris: BJK05_07870 Help Entry BJK05_07870       CDS       T05195                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ppoa  Pectobacterium polaris Brite KEGG Orthology (KO) [BR:ppoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ppoa03400]     BJK05_07870 DNA repair and recombination proteins [BR:ppoa03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     BJK05_07870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RWD Motif Other DBs NCBI-ProteinID:  ASY79917 UniProt:  A0AAP9BKM8 LinkDB All DBs Position 1819651..1819890 Genome browser AA seq 79 aa AA seqDB search MRVEITLAKTTPLPAGAIEALRHELEKRIHKIYPDTPIQVRYTSANSLTVMGAGKEDKDR ISEILQETWESADDWFTAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcgcgtagaaatcactcttgcaaagacaacgcctttacccgccggtgccatcgaagca ctcaggcatgagctggaaaaacgtattcataaaatttatcccgatacccccattcaggtt cgttatacatccgcaaacagcctgacggtaatgggagccggcaaagaggacaaagatcgt atctctgaaatcttgcaggaaacgtgggaaagtgccgatgactggtttacggcagagtaa

DBGET integrated database retrieval system