Pectobacterium polaris: BJK05_08940 Help Entry BJK05_08940       CDS       T05195                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ppoa  Pectobacterium polaris Pathway ppoa00190   Oxidative phosphorylation ppoa01100   Metabolic pathways ppoa02020   Two-component system Module ppoa_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ppoa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BJK05_08940  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BJK05_08940 Enzymes [BR:ppoa01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BJK05_08940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ASY80116 LinkDB All DBs Position 2052512..2052616 Genome browser AA seq 34 aa AA seqDB search MWYFAWILGTLLACAFALVTALAVENHEAGKDAS NT seq 105 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggatactcggcacgctgctggcctgcgcgttcgcgctggttact gcgctggcagtagagaaccatgaagcgggaaaagacgcttcgtga

DBGET integrated database retrieval system