Pectobacterium polaris: BJK05_16405 Help Entry BJK05_16405       CDS       T05195                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppoa  Pectobacterium polaris Pathway ppoa00998   Biosynthesis of various antibiotics ppoa01100   Metabolic pathways ppoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJK05_16405    00074 Mycolic acid biosynthesis     BJK05_16405   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJK05_16405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASY81485 UniProt:  A0AAP9BJ39 LinkDB All DBs Position complement(3740626..3740892) Genome browser AA seq 88 aa AA seqDB search MESMFVEIKEMIIDSLNLEDISVDEIETDAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEVRQHFFSVATLAAFINTQRAVSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaagtatgtttgttgaaatcaaagagatgattatcgactctcttaatcttgaagat atcagcgttgatgaaatagaaacggacgccccgctttttggcgaaggacttggtctggat tctatcgatgcacttgagttgggattagcggtaaaaaaccgttatggcgtcgtgctttct gcggaaagtgaagaggttcgccaacacttcttttccgttgcaacccttgcagcttttatc aacactcagcgcgccgtgagtgcctga

DBGET integrated database retrieval system