Paenibacillus polymyxa CR1: X809_30305 Help Entry X809_30305        CDS       T02956                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ppol  Paenibacillus polymyxa CR1 Pathway ppol02024   Quorum sensing ppol03018   RNA degradation Brite KEGG Orthology (KO) [BR:ppol00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     X809_30305  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     X809_30305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppol03019]     X809_30305    03036 Chromosome and associated proteins [BR:ppol03036]     X809_30305 Messenger RNA biogenesis [BR:ppol03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      X809_30305 Chromosome and associated proteins [BR:ppol03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     X809_30305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF150_C Motif Other DBs NCBI-ProteinID:  AIW40337 LinkDB All DBs Position complement(3311054..3311299) Genome browser AA seq 81 aa AA seqDB search MNKSINIQDTFLNQLRKDSIPVTVYLINGFQVRGTIKAFDNFTIVIDSDGKQQLIYKHAI STFTPQRNVSLVQQQDNASDN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccattaatatccaagatacgtttctgaatcaattgcgcaaggattctata cctgtaacggtatacctcatcaatggatttcaggtgcgagggacgattaaagcatttgac aattttacgattgttatcgactcggatggaaagcaacagctgatttacaagcatgccatc tccacctttacaccgcaacgcaatgtatcgcttgtacagcaacaggataacgctagcgat aactga

DBGET integrated database retrieval system