Pectobacterium polonicum: LW347_13280 Help Entry LW347_13280       CDS       T08488                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism ppoo  Pectobacterium polonicum Pathway ppoo02020   Two-component system ppoo02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:ppoo00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     LW347_13280 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     LW347_13280 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:ppoo02035]     LW347_13280 (flgM) Bacterial motility proteins [BR:ppoo02035]  Flagellar system   Flagellar assembly proteins    Others     LW347_13280 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF6285 Motif Other DBs NCBI-ProteinID:  UVO06889 UniProt:  A0AAE9NMP3 LinkDB All DBs Position 2952461..2952757 Genome browser AA seq 98 aa AA seqDB search MSIDRTQSLKPVSQVQQRESGDIVKTKRKQAETQSEVSATQVKLSDAQAKLMQPGTQDID MARVETLKQAIRDGSLKIDTGRIADALLKETRDFLAGN NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagtattgatcgcacacaatcactgaagccggtcagtcaagtgcaacaacgcgaatct ggcgatatcgttaaaaccaagcgtaaacaagctgaaactcagtctgaagtcagcgcaaca caggtaaagctgagcgatgcacaggcaaaattgatgcagcctggtacgcaggatatagac atggctcgcgttgaaaccttgaaacaggcaattcgtgatggctcacttaaaattgatacc ggaagaattgctgatgcgctacttaaagaaacgcgggattttttagcaggtaattaa

DBGET integrated database retrieval system