Pseudodesulfovibrio portus: JCM14722_18130 Help Entry JCM14722_18130    CDS       T08636                                  Name (GenBank) (Fe-S)-binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ppor  Pseudodesulfovibrio portus Pathway ppor00020   Citrate cycle (TCA cycle) ppor00720   Other carbon fixation pathways ppor01100   Metabolic pathways ppor01110   Biosynthesis of secondary metabolites ppor01120   Microbial metabolism in diverse environments ppor01200   Carbon metabolism ppor01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ppor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     JCM14722_18130   09102 Energy metabolism    00720 Other carbon fixation pathways     JCM14722_18130 Enzymes [BR:ppor01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      JCM14722_18130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_2 Fer4_7 LdpA_Fe-S-bd Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_3 Fer4_15 Fer4_22 Fer4_13 Fer4_17 Motif Other DBs NCBI-ProteinID:  BDQ34271 UniProt:  A0ABN6RT64 LinkDB All DBs Position 1925166..1925399 Genome browser AA seq 77 aa AA seqDB search MSRIEVQEDRCKGCLLCTTVCPVDIIVQSDRFNTSGYKVVEVPEADADKCTGCASCAQIC PDVAIKVYRTPKEKGGK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctcgaatcgaggtccaggaagatcggtgcaagggctgtctgctctgtaccaccgtc tgtcccgtagacatcatcgtccagtcggaccgcttcaacacaagcggctacaaggtcgtc gaggtgcctgaggcggacgcggacaaatgtaccggatgcgcatcctgcgcgcagatctgc ccggacgtggcgatcaaggtttacaggacccccaaggaaaaagggggaaagtag

DBGET integrated database retrieval system