Papilio polytes (common Mormon): 106105649 Help Entry 106105649         CDS       T07437                                  Name (RefSeq) bombyxin A-1 homolog   KO K04526   insulin Organism ppot  Papilio polytes (common Mormon) Pathway ppot04068   FoxO signaling pathway ppot04081   Hormone signaling ppot04140   Autophagy - animal ppot04150   mTOR signaling pathway ppot04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:ppot00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106105649    04150 mTOR signaling pathway     106105649   09133 Signaling molecules and interaction    04081 Hormone signaling     106105649  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106105649  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     106105649  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppot04052]     106105649 Cytokines and neuropeptides [BR:ppot04052]  Neuropeptides   Unclassified    106105649 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  106105649 NCBI-ProteinID:  XP_013141527 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MKFIIFTFVTCLVLATCYAHIGGGAALQNISPQVYCGRSLARAMAFLCFEEDGFEKRSDM GTMYGQILPPYYKEQDVQMGLPWAGRARSLSLAGRGKRTPGIVTECCDKPCSINELLSYC NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaaattcataattttcaccttcgtaacttgcctggttctggccacgtgctacgcgcac atcggcggcggcgcggcgctccagaacatcagcccacaagtctactgtggcagatctttg gccagagctatggccttcctttgctttgaggaagatggcttcgaaaaacgatccgatatg ggaaccatgtatggacaaattctgcccccgtattacaaagagcaagatgtccagatgggt ctgccgtgggctggtcgggcacgaagcttgtcccttgcgggccgtggcaagcgcaccccc ggcatcgtcaccgagtgctgcgacaaaccctgcagcatcaacgaacttctcagctactgc taa

DBGET integrated database retrieval system