KEGG   Papilio polytes (common Mormon): 106109434
Entry
106109434         CDS       T07437                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ppot  Papilio polytes (common Mormon)
Pathway
ppot00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ppot00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106109434
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ppot00199]
    106109434
Enzymes [BR:ppot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106109434
Cytochrome P450 [BR:ppot00199]
 Cytochrome P450, animal type
  CYP306 family
   106109434
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106109434
NCBI-ProteinID: XP_013146390
LinkDB
Position
Unknown
AA seq 539 aa
MDFIFLWLVTFVLGFWICKKMKEWRSLPPGPWGLPIVGFLPFMDGNQPHLTLTKVAKQFG
PIFGISMGSVYTVVLSDHKLVREAFAKDAFSGRAPLYLTHGIMHGNGIICAEGGLWKDQR
KLVTMWLKSFGMSKHSVSRDKLERRIAVGVNELLQNVKEASGAPIDLTSMLANSLGNVVN
EIIFGYKYPSDDKTWKWFRQIQEEGSHEMGVAGVVNFLPFIRFFSRSIQKTMSILTRGQA
QTHSLYAAIVEKRRKVLKLEAPEGAKYPLHENLFNQHPKGFIKCIKYSKHVSETEEHYFD
PEILIPTDGECILDNFLLEQKKRFDSGDETAKYMTDEQMFYLLADMFGAGLDTTSTTLAW
FLLYMALHPEEQETVRREIQTVLIDDNDCDYTKLPRLMAAICETQRIRSIVPVGIPHGCI
EDTYLGDYRIPKGTMVMPLQWAMHMDPDVWEDPEEFKPSRFLDADGNLLKPQQFIPFQTG
KRMCPGDELSRMMSCGLITRLFRHMRVQLVDGPPTEVEMQGTVGVTMTPPKTLYVCVPL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggatttcatatttttatggctagttactttcgtactgggattttggatctgtaagaag
atgaaggagtggcgcagcttgcctcctggtccttggggtttaccgatcgtgggattcttg
ccatttatggatggaaaccagccccatctgactttgactaaggtcgctaaacaattcggc
ccaatatttggaatatcaatgggcagcgtgtatacggtagtgctgtcagatcataaatta
gtaagagaagctttcgcaaaggatgccttctcaggacgggctccgctttatttgactcat
ggtatcatgcacggaaatggtataatttgtgctgagggtggattatggaaggatcaacgc
aaactggtgacgatgtggctgaaaagcttcgggatgagcaaacacagtgtgtcccgcgac
aaattggagagacgcatcgcagtcggcgttaatgaactgttacaaaacgtcaaagaagcc
tctggggcccctattgatctaacatcgatgctagcaaactcactgggaaacgtcgtaaat
gaaattatatttggttacaaatatccttctgatgacaaaacatggaaatggttcagacaa
atacaagaagaaggtagtcatgaaatgggcgttgctggggttgttaactttttgcctttc
attcgattcttttcacggtcaattcaaaaaacgatgagcatactaacacgtggtcaggca
caaactcactctctctacgctgctattgttgaaaagcgacgcaaagtattaaaacttgaa
gctcctgaaggtgctaaatatccgttacatgaaaatcttttcaaccagcatcctaaaggc
tttataaaatgtataaaatacagcaaacatgtatcagaaacggaggaacattacttcgat
cccgaaattcttataccgacagatggtgaatgtattcttgacaatttcctcttggaacaa
aagaaacggttcgacagcggcgatgagactgcaaagtacatgacagatgaacagatgttt
tatctgctcgcggacatgttcggggcaggccttgataccacgtcgactactctcgcctgg
tttttgttgtatatggctctgcacccggaagaacaggagacggtacgtcgtgagatccag
accgttttaattgatgataatgattgcgattatacaaagttacctcgattaatggcggcc
atttgtgagactcagcgcattcgatctatagttccagttggcattcctcatggatgtatt
gaagatacgtatttaggtgactacaggattcccaaaggcacaatggtaatgccgctgcag
tgggcgatgcacatggatcctgacgtttgggaggatcccgaggagtttaagcccagtcga
tttttggatgcagatgggaatttattgaagccgcaacaattcataccttttcaaacagga
aagcgaatgtgccctggagatgagctttctcggatgatgtcgtgtggattgataacacgt
ttgttccgacacatgcgtgtacaattagtcgatggtccacccactgaagtggaaatgcaa
ggtacagtcggtgtcaccatgacaccgcctaagacgttgtatgtttgtgtaccgctttaa

DBGET integrated database retrieval system