Papilio polytes (common Mormon): 106110268 Help Entry 106110268         CDS       T07437                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism ppot  Papilio polytes (common Mormon) Pathway ppot04144   Endocytosis ppot04517   IgSF CAM signaling ppot04518   Integrin signaling ppot04519   Cadherin signaling ppot05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ppot00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106110268    04518 Integrin signaling     106110268    04519 Cadherin signaling     106110268  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106110268  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106110268  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppot04131]     106110268    03036 Chromosome and associated proteins [BR:ppot03036]     106110268   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppot04147]     106110268    04031 GTP-binding proteins [BR:ppot04031]     106110268 Membrane trafficking [BR:ppot04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106110268  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     106110268   Macropinocytosis    Ras GTPases     106110268 Chromosome and associated proteins [BR:ppot03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     106110268 Exosome [BR:ppot04147]  Exosomal proteins   Exosomal proteins of microglial cells    106110268   Exosomal proteins of breast milk    106110268 GTP-binding proteins [BR:ppot04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106110268 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  106110268 NCBI-ProteinID:  XP_013147485 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHQQKTPFLLVGTQIDLR DDPATMEKLAKIKQKPVSLEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPPKKKGCRIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactattaaatgtgtagtagttggtgatggggcggttggtaaaacatgtcttctg atcagttatacaaccaacaagttcccatcggaatatgtgccaacagtctttgataattat gctgtaactgtcatgattggtggggaaccatacactttgggactctttgacactgcaggt caggaagattatgatagactacgtcccttgagttatcctcaaacagatgttttcctcgtt tgcttcagtgtggtgagcccgagctcctttgaaaatgtgaaggaaaagtgggtgccagaa attactcatcatcagcaaaagacaccattcctcctggttgggactcagatagatttacgt gatgatcccgctactatggagaaacttgctaagatcaaacagaaaccagtgtcccttgaa caaggagagaaactcgctaaagaactcaaggctgtcaaatatgtggagtgttcagcactg actcagaaaggattgaaaaatgtattcgatgaagctattcttgctgcattggagcctccg gaaccaccaaagaaaaagggatgcaggattctgtaa

DBGET integrated database retrieval system