Paenibacillus polymyxa Sb3-1: RE92_02360
Help
Entry
RE92_02360 CDS
T03812
Name
(GenBank) chemotaxis protein CheY
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ppoy
Paenibacillus polymyxa Sb3-1
Pathway
ppoy02020
Two-component system
ppoy02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
ppoy00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
RE92_02360
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
RE92_02360
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
ppoy02022
]
RE92_02360
02035 Bacterial motility proteins [BR:
ppoy02035
]
RE92_02360
Two-component system [BR:
ppoy02022
]
CheA family
CheA-CheYBV (chemotaxis)
RE92_02360
Bacterial motility proteins [BR:
ppoy02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
RE92_02360
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
B12-binding
DUF3798
HydF_dimer
Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID:
AJE49972
UniProt:
A0A0F0G8C8
LinkDB
All DBs
Position
complement(597062..597427)
Genome browser
AA seq
121 aa
AA seq
DB search
MANRILIVDDAAFMRMMIRDILSKNGFEVVGEAQDGSQAIEKFKELRPDLITMDITMPEM
DGIAALKEIKQIDPNAKVIMCSAMGQQAMVIDAIQAGAKDFIVKPFQSDRVIEAINKTLG
V
NT seq
366 nt
NT seq
+upstream
nt +downstream
nt
atggcaaaccgtattttgatcgtggacgatgctgcatttatgagaatgatgattcgggac
atcctgtccaaaaatggatttgaagtagtaggagaggcccaggatggatcacaggccatt
gaaaaattcaaggagcttcgtcctgacctgattacgatggatatcacgatgcctgagatg
gacggcattgccgctctgaaggaaatcaaacaaattgacccgaatgcaaaggttatcatg
tgttccgcgatgggtcagcaagctatggtaattgatgccattcaagctggcgcaaaagat
tttatcgttaagccattccaatcggatcgggttatcgaagccatcaacaagacactgggt
gtgtaa
DBGET
integrated database retrieval system