Paenibacillus polymyxa Sb3-1: RE92_05775 Help Entry RE92_05775        CDS       T03812                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism ppoy  Paenibacillus polymyxa Sb3-1 Pathway ppoy03060   Protein export ppoy03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ppoy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     RE92_05775  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     RE92_05775  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ppoy02044]     RE92_05775 Secretion system [BR:ppoy02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    RE92_05775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 Motif Other DBs NCBI-ProteinID:  AJE50600 LinkDB All DBs Position complement(1298037..1298288) Genome browser AA seq 83 aa AA seqDB search MPNIGAPGYILLIILALLLFGPNKLPELGRAVGRTFREFKNGARDILSEDERTGGKESKD SVVQASQTTPSEVQTQPEDKRLS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcccaatattggagcaccgggttatattttgttaattattctggcgctgctgctattt ggtccgaacaagctgcctgagctgggccgagctgtagggcgtacattccgtgaatttaaa aacggggcacgcgatattttatctgaagatgaacggactgggggtaaagaaagcaaagat agtgtggtccaagcatcacagacaacgccttcagaagttcaaactcagcctgaggataaa cgcttgtcatag

DBGET integrated database retrieval system