Paenibacillus polymyxa SQR-21: PPSQR21_027780 Help Entry PPSQR21_027780    CDS       T03178                                  Symbol hfq Name (GenBank) hfq   KO K03666   host factor-I protein Organism ppq  Paenibacillus polymyxa SQR-21 Pathway ppq02024   Quorum sensing ppq03018   RNA degradation Brite KEGG Orthology (KO) [BR:ppq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PPSQR21_027780 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PPSQR21_027780 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppq03019]     PPSQR21_027780 (hfq)    03036 Chromosome and associated proteins [BR:ppq03036]     PPSQR21_027780 (hfq) Messenger RNA biogenesis [BR:ppq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PPSQR21_027780 (hfq) Chromosome and associated proteins [BR:ppq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PPSQR21_027780 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF150_C Motif Other DBs NCBI-ProteinID:  AHM66420 LinkDB All DBs Position complement(3199566..3199832) Genome browser AA seq 88 aa AA seqDB search MIIGGTAKMNKSINIQDTFLNQLRKDSIPVTVYLINGFQVRGTIKAFDNFTIVIDSDGKQ QLIYKHAISTFTPQRNVSLVQQDNASDN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgattattgggggtacggctaaaatgaacaagtctattaatatccaagatacgtttctg aaccaattgcgcaaggattctatacctgtaacggtatacctcatcaatggattccaggtg cgaggaacgattaaagcatttgacaattttacaattgttatcgattcggatgggaagcaa cagctgatctacaagcatgctatctccacctttacaccgcaacgcaacgtatcgcttgta caacaagataacgctagcgataactga

DBGET integrated database retrieval system