Photobacterium profundum: PBPRA1196 Help Entry PBPRA1196         CDS       T00173                                  Symbol BB3755 Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ppr  Photobacterium profundum Pathway ppr01100   Metabolic pathways ppr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PBPRA1196 (BB3755)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PBPRA1196 (BB3755) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB EutQ Motif Other DBs NCBI-ProteinID:  CAG19607 UniProt:  Q9R6Z3 LinkDB All DBs Position 1:1345302..1345538 Genome browser AA seq 78 aa AA seqDB search MSNIEDRVRKIIIEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEAA EKITTVQAAIDYVNSASE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagatcgcgtaagaaaaatcatcattgagcaactaggtgtggacgaa gcagaagttaagaacgaagcttctttcgttgacgatctaggtgctgattcactagataca gttgaactagtaatggctcttgaagaagaattcgataccgaaattcctgacgaagcagct gaaaaaattactacagttcaagctgcaatcgactacgtaaacagcgcttctgagtaa

DBGET integrated database retrieval system