Photobacterium profundum: PBPRA3528 Help Entry PBPRA3528         CDS       T00173                                  Symbol S3879 Name (GenBank) hypothetical protein   KO K01749   hydroxymethylbilane synthase [EC:2.5.1.61] Organism ppr  Photobacterium profundum Pathway ppr00860   Porphyrin metabolism ppr01100   Metabolic pathways ppr01110   Biosynthesis of secondary metabolites ppr01120   Microbial metabolism in diverse environments ppr01240   Biosynthesis of cofactors Module ppr_M00121   Heme biosynthesis, plants and bacteria, glutamate => heme ppr_M00846   Siroheme biosynthesis, glutamyl-tRNA => siroheme Brite KEGG Orthology (KO) [BR:ppr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     PBPRA3528 (S3879) Enzymes [BR:ppr01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.61  hydroxymethylbilane synthase      PBPRA3528 (S3879) SSDB OrthologParalogGFIT Motif Pfam:  Porphobil_deamC Motif Other DBs NCBI-ProteinID:  CAG21799 UniProt:  Q6LLM9 LinkDB All DBs Position 1:3989453..3989767 Genome browser AA seq 104 aa AA seqDB search MDDQRVRALLAPLNHHETATRIFCERAMNNRLQGGCQVPIGSYSELQGDQIWLRALVGEP DGSKMVRGEITGPAIDGEALGTQLAEQLLADGAKEILDELYGNA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt ttggatgatcaacgtgttagagcactattagcgcccctgaatcaccatgaaacagcaaca cgtattttctgtgaacgcgcaatgaataaccgcctacaaggtggctgccaagtacctatt ggcagttactctgaactgcaaggtgatcaaatttggttacgtgccttagtcggtgaacct gatggcagcaaaatggttcgtggtgagataacaggaccagccattgacggtgaagcattg ggcacccaacttgccgaacaactactggctgacggtgcaaaagaaattttagacgagctt tacggcaacgcataa

DBGET integrated database retrieval system