Pseudomonas promysalinigenes: HU725_006975 Help Entry HU725_006975      CDS       T07662                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pprg  Pseudomonas promysalinigenes Pathway pprg01100   Metabolic pathways pprg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pprg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU725_006975 (acpP)    00074 Mycolic acid biosynthesis     HU725_006975 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU725_006975 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 Fas_alpha_ACP HLH DUF1493 DUF6952 Motif Other DBs NCBI-ProteinID:  QXI35083 LinkDB All DBs Position 1507737..1507973 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTAEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVKNHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaggaagtgactgctgagaagtccttcgtcgatgacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgcaatcgactacgtcaagaaccaccaggcttaa

DBGET integrated database retrieval system