Pimephales promelas (fathead minnow): 120460588 Help Entry 120460588         CDS       T08155                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04010   MAPK signaling pathway pprm04068   FoxO signaling pathway pprm04081   Hormone signaling pprm04114   Oocyte meiosis pprm04140   Autophagy - animal pprm04150   mTOR signaling pathway pprm04810   Regulation of actin cytoskeleton pprm04910   Insulin signaling pathway pprm04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120460588 (insb)    04068 FoxO signaling pathway     120460588 (insb)    04150 mTOR signaling pathway     120460588 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     120460588 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120460588 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     120460588 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120460588 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120460588 (insb)    04914 Progesterone-mediated oocyte maturation     120460588 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pprm04052]     120460588 (insb) Cytokines and neuropeptides [BR:pprm04052]  Neuropeptides   Unclassified    120460588 (insb) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  120460588 NCBI-ProteinID:  XP_039504353 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MVLLQAATIILLLASLSGSLSTPSQHLCGSNLVDALYHVCGAKGFFHSNRGRRDLDNLLV LLSNLADYEVAPLKEKVMKRKRGIVERCCHRPCTIYHLEDYCS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggtgttgctacaggccgcaacaataattctgctgttggcctccctgtctggatccctc tctactccatcacagcatctgtgtggctctaacctggtggatgcactttaccatgtgtgt ggggctaaaggattctttcactccaacagaggcaggagggacctggataacttgctggtc ttgctctcaaatttggcagattatgaggtcgctccattaaaagagaaggtgatgaagagg aagagaggaattgtggaacggtgctgccacaggccctgcactatctaccaccttgaagac tactgcagctga

DBGET integrated database retrieval system