Pimephales promelas (fathead minnow): 120473360 Help Entry 120473360         CDS       T08155                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04010   MAPK signaling pathway pprm04012   ErbB signaling pathway pprm04068   FoxO signaling pathway pprm04137   Mitophagy - animal pprm04140   Autophagy - animal pprm04144   Endocytosis pprm04150   mTOR signaling pathway pprm04210   Apoptosis pprm04218   Cellular senescence pprm04370   VEGF signaling pathway pprm04371   Apelin signaling pathway pprm04510   Focal adhesion pprm04540   Gap junction pprm04625   C-type lectin receptor signaling pathway pprm04810   Regulation of actin cytoskeleton pprm04910   Insulin signaling pathway pprm04912   GnRH signaling pathway pprm04916   Melanogenesis pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120473360 (hrasa)    04012 ErbB signaling pathway     120473360 (hrasa)    04370 VEGF signaling pathway     120473360 (hrasa)    04371 Apelin signaling pathway     120473360 (hrasa)    04068 FoxO signaling pathway     120473360 (hrasa)    04150 mTOR signaling pathway     120473360 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120473360 (hrasa)    04140 Autophagy - animal     120473360 (hrasa)    04137 Mitophagy - animal     120473360 (hrasa)   09143 Cell growth and death    04210 Apoptosis     120473360 (hrasa)    04218 Cellular senescence     120473360 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120473360 (hrasa)    04540 Gap junction     120473360 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120473360 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120473360 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     120473360 (hrasa)    04912 GnRH signaling pathway     120473360 (hrasa)    04916 Melanogenesis     120473360 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120473360 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pprm04131]     120473360 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120473360 (hrasa)    04031 GTP-binding proteins [BR:pprm04031]     120473360 (hrasa) Membrane trafficking [BR:pprm04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120473360 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     120473360 (hrasa) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120473360 (hrasa)   Exosomal proteins of colorectal cancer cells    120473360 (hrasa) GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120473360 (hrasa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  120473360 NCBI-ProteinID:  XP_039519091 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaactggtggtggtgggtgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatatgaccctactatagaggactcctac aggaagcaggtggtgattgacggggagacgtgtcttctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggattcctttgt gtctttgccatcaataacaccaagtcctttgaggacattcatcaatacagggaacaaatc aaacgggtgaaggactctgatgacgtgcccatggtgctggtggggaacaaatgcgacctc ccgactcggacagtggacacgcggcaagcgcaggagctcgcccgcagctacgggatccct ttcatcgagacatcggccaaaaccagacagggtgtggaggacgcgttttacacgctcgta cgagagatccgtcaacacaaaatgaggaagctgaaccccccggatgagagtggacaggac tgcatgagctgccgctgtgtcgtgtcgtga

DBGET integrated database retrieval system