Pimephales promelas (fathead minnow): 120474677 Help Entry 120474677         CDS       T08155                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04010   MAPK signaling pathway pprm04012   ErbB signaling pathway pprm04068   FoxO signaling pathway pprm04137   Mitophagy - animal pprm04140   Autophagy - animal pprm04150   mTOR signaling pathway pprm04210   Apoptosis pprm04218   Cellular senescence pprm04370   VEGF signaling pathway pprm04371   Apelin signaling pathway pprm04540   Gap junction pprm04625   C-type lectin receptor signaling pathway pprm04810   Regulation of actin cytoskeleton pprm04910   Insulin signaling pathway pprm04912   GnRH signaling pathway pprm04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120474677 (nras)    04012 ErbB signaling pathway     120474677 (nras)    04370 VEGF signaling pathway     120474677 (nras)    04371 Apelin signaling pathway     120474677 (nras)    04068 FoxO signaling pathway     120474677 (nras)    04150 mTOR signaling pathway     120474677 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120474677 (nras)    04137 Mitophagy - animal     120474677 (nras)   09143 Cell growth and death    04210 Apoptosis     120474677 (nras)    04218 Cellular senescence     120474677 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     120474677 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120474677 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120474677 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     120474677 (nras)    04912 GnRH signaling pathway     120474677 (nras)    04916 Melanogenesis     120474677 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pprm04131]     120474677 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120474677 (nras)    04031 GTP-binding proteins [BR:pprm04031]     120474677 (nras) Membrane trafficking [BR:pprm04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120474677 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     120474677 (nras) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120474677 (nras)   Exosomal proteins of other body fluids (saliva and urine)    120474677 (nras)   Exosomal proteins of breast cancer cells    120474677 (nras)   Exosomal proteins of colorectal cancer cells    120474677 (nras) GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120474677 (nras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  120474677 NCBI-ProteinID:  XP_039521099 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLDSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagttggttgttgtgggagcaggtggtgttgggaagagcgcattaacc atccagcttattcagaatcactttgtggatgaatatgaccccactattgaggactcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgc gtcttcgccataaacaacagcaaatcctttgccgacgtgcatttgtacagagagcagatc aagcgcgtgaaggattcagatgatgttcccatggtcctagttgggaacaaatgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt gtagaaacttctgccaagaccagacagggagttgaggatgctttttacaccctcgtccgt gagatccggcattatcgcatgaaaaagctcgacagcagagaagataggaagcagggctgc ctgggtgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system