Pimephales promelas (fathead minnow): 120481340 Help Entry 120481340         CDS       T08155                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04137   Mitophagy - animal pprm04140   Autophagy - animal pprm04144   Endocytosis pprm04145   Phagosome pprm04148   Efferocytosis pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120481340    04145 Phagosome     120481340    04140 Autophagy - animal     120481340    04137 Mitophagy - animal     120481340    04148 Efferocytosis     120481340  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120481340  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pprm04131]     120481340   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120481340    04031 GTP-binding proteins [BR:pprm04031]     120481340 Membrane trafficking [BR:pprm04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120481340 Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120481340   Exosomal proteins of other body fluids (saliva and urine)    120481340   Exosomal proteins of colorectal cancer cells    120481340   Exosomal proteins of bladder cancer cells    120481340 GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120481340 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP Septin nSTAND3 AAA_7 AAA_16 NTPase_1 G-alpha AAA_22 AAA_24 ATPase_2 SRPRB ABC_tran AAA_5 ATP-synt_ab AAA_14 NACHT MCM Motif Other DBs NCBI-GeneID:  120481340 NCBI-ProteinID:  XP_039530887 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTMDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETVD TYDFPDQIKLRDDRPASTSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaagaaggtcctgctcaaagtgatcatcctaggggattctggagttggg aagacctctttgatgaaccagtatgtgaataataagttcagtaatcagtataaggccact atcggagccgacttcctgaccaaggaggtgatggtggacgacagactggtcaccatgcag atctgggacacagcaggccaggagagatttcagtctctcggcgtggctttctaccgaggg gccgactgttgcgtgctggtctatgatgtcacggcacccactacattcaagactatggac agctggagggacgagtttctcattcaggccagtccacgtgacccagagaacttcccattt gttgtgctgggaaacaaaatcgacctggaaaaccgacaggtaacaacgaagcgggcacaa gcatggtgtcagagtaagaacaacatcccctattttgagaccagtgctaaagaagccatt aacgtggagcaggccttccaaaccattgctcgcaatgcacttaaacaggagactgtggac acatatgatttccctgaccagattaaactaagagacgacagacctgcgtccaccagtgac ggctgcagctgctga

DBGET integrated database retrieval system