Pimephales promelas (fathead minnow): 120482131 Help Entry 120482131         CDS       T08155                                  Symbol hmgb1a Name (RefSeq) high mobility group protein B1a   KO K10802   high mobility group protein B1 Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm03410   Base excision repair pprm04140   Autophagy - animal pprm04217   Necroptosis Brite KEGG Orthology (KO) [BR:pprm00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     120482131 (hmgb1a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120482131 (hmgb1a)   09143 Cell growth and death    04217 Necroptosis     120482131 (hmgb1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pprm03036]     120482131 (hmgb1a)    03400 DNA repair and recombination proteins [BR:pprm03400]     120482131 (hmgb1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120482131 (hmgb1a) Chromosome and associated proteins [BR:pprm03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     120482131 (hmgb1a) DNA repair and recombination proteins [BR:pprm03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      120482131 (hmgb1a)    MMR (mismatch excision repair)     Other MMR factors      120482131 (hmgb1a) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120482131 (hmgb1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 NOA36 Cwf_Cwc_15 Motif Other DBs NCBI-GeneID:  120482131 NCBI-ProteinID:  XP_039532079 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFE DMAKLDKVRYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCAEFRPKVKEDTPGLS IGDVAKKLGEMWNKTASEDKQPYEKKAAKLKEKYEKDIAAYRSKGKVGGATAKAPSKPDK VNDDDDDDDDDDEEDDDDDDDDDDE NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggggaaggatccaacaaaaccaagaggcaaaatgtcctcgtacgcatactttgtccag acctgccgagaggaacataagaagaaacacccggaggcatcggtcaacttctctgagttt tccaaaaagtgctctgagcgatggaagactatgtcagctaaggaaaaagggaagtttgaa gatatggccaaacttgacaaggtgcgttatgagagggagatgaagaactacattccaccc aaaggcgagaagaaaaagaggtttaaagaccccaatgctcccaagagacccccgtcagca ttcttcattttctgcgccgagttccgacccaaggtaaaagaagatacccctggtctgtct attggagacgtggccaagaaactgggtgagatgtggaacaaaacagcatctgaggataag caaccatatgaaaagaaggctgccaagctgaaggagaagtatgagaaggacattgccgcc tatcgctctaaaggcaaagtgggaggcgccacagccaaagccccttccaagccggacaag gttaacgatgatgacgacgacgacgatgatgatgatgaggaagatgacgatgatgatgac gacgacgatgacgagtag

DBGET integrated database retrieval system