Pimephales promelas (fathead minnow): 120482427 Help Entry 120482427         CDS       T08155                                  Symbol pfn2l Name (RefSeq) profilin 2 like isoform X1   KO K05759   profilin Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04810   Regulation of actin cytoskeleton pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120482427 (pfn2l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120482427 (pfn2l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pprm04131]     120482427 (pfn2l)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pprm04812]     120482427 (pfn2l)    04147 Exosome [BR:pprm04147]     120482427 (pfn2l) Membrane trafficking [BR:pprm04131]  Others   Actin-binding proteins    Others     120482427 (pfn2l) Cytoskeleton proteins [BR:pprm04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120482427 (pfn2l) Exosome [BR:pprm04147]  Exosomal proteins   Proteins found in most exosomes    120482427 (pfn2l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin RodZ_C Motif Other DBs NCBI-GeneID:  120482427 NCBI-ProteinID:  XP_039532686 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MSWQSYVDNLMADGSCQDAAIVGYTDAKYVWASSEGGTFSGITPDEIDVIVGKDREAFFT SGLTLGKKKCSVIRDSLPLEGDWTMDIRTKSHNGEPTYNVSIGRAGKVLVVVMGKEGTHG GSLNKKAFSMAEYLRKVGY NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgtcttggcaaagctacgtggataacctgatggccgatggcagctgccaggatgccgcc attgttggctacacggacgccaaatatgtttgggcatcgtcagaggggggtacttttagc ggtataacgcctgatgaaatcgatgtcattgttggcaaagaccgagaggcctttttcacc agtgggctgactttagggaaaaagaagtgctctgtgatcagagacagtcttccactggaa ggcgactggacaatggacatcaggacaaagagtcataatggagagccgacatacaatgtt tccataggcagagctggcaaagtgttggttgtagtcatgggaaaggaaggtacccacgga ggatcgctcaacaagaaagcatttagcatggctgagtacctgaggaaagttggatactaa

DBGET integrated database retrieval system