Pimephales promelas (fathead minnow): 120484555 Help Entry 120484555         CDS       T08155                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04382   Cornified envelope formation pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120484555 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120484555 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120484555 (s100a10b) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of microglial cells    120484555 (s100a10b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EH EF-hand_STIM1 Motif Other DBs NCBI-GeneID:  120484555 NCBI-ProteinID:  XP_039535724 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MPSDLERAMETLIMVFHRYADTEGSKASLSRKELKLLMEKELSSFLKTQKDPAAIDKIMR DLDSNGDGEVNFEEFVSLVVGLSIACEQIYQLHKQTPAGVKKN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccttctgacctggagagagcaatggaaactctgatcatggtgtttcaccgttatgcc gacacagagggtagcaaagcatccctgagtcgcaaagagctcaaactgctgatggagaaa gaactgtctagctttctgaagactcagaaggaccctgctgccattgacaagattatgagg gatctggactctaatggagatggagaggtgaattttgaagagttcgtgtctcttgtggtg ggcctctccattgcctgtgaacagatctaccagctgcataagcagactcctgctggtgtc aaaaagaattaa

DBGET integrated database retrieval system