Pimephales promelas (fathead minnow): 120484761 Help Entry 120484761         CDS       T08155                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04010   MAPK signaling pathway pprm04144   Endocytosis pprm04370   VEGF signaling pathway pprm04510   Focal adhesion pprm04520   Adherens junction pprm04530   Tight junction pprm04810   Regulation of actin cytoskeleton pprm04912   GnRH signaling pathway pprm05100   Bacterial invasion of epithelial cells pprm05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120484761 (cdc42l)    04370 VEGF signaling pathway     120484761 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120484761 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120484761 (cdc42l)    04520 Adherens junction     120484761 (cdc42l)    04530 Tight junction     120484761 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120484761 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     120484761 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120484761 (cdc42l)    05100 Bacterial invasion of epithelial cells     120484761 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pprm04131]     120484761 (cdc42l)    03036 Chromosome and associated proteins [BR:pprm03036]     120484761 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120484761 (cdc42l)    04031 GTP-binding proteins [BR:pprm04031]     120484761 (cdc42l) Membrane trafficking [BR:pprm04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120484761 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     120484761 (cdc42l)   Macropinocytosis    Ras GTPases     120484761 (cdc42l) Chromosome and associated proteins [BR:pprm03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120484761 (cdc42l) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of microglial cells    120484761 (cdc42l)   Exosomal proteins of breast milk    120484761 (cdc42l) GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120484761 (cdc42l) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  120484761 NCBI-ProteinID:  XP_039536117 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCLLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggagatggagctgtcggaaagacctgcctcctc atttcatacacaaccaacaaattcccctctgaatatgttcccacggtttttgacaactat gctgtcacagtgatgatcggaggggaaccttatacactggggcttttcgacacagcaggt caggaagactatgacagacttcggcctctcagctatccgcagacagacgtattccttgtt tgcttctctgttgtttctccttcctcctttgagaatgtgaaagagaagtgggtaccggag atctctcaccactgtccacgcactccgttccttctggtgggcactcaggttgacctgagg gacgacagtaacactgtggaaaaacttgccaaaaacaaacagcgccccatatcgcctgag agcggggagaagctggccagagacctcagagctgtcaaatacgtggagtgctccgccctc acacagagaggccttaagaatgttttcgacgaggcgatactcgctgcccttgaacctcca gagacgaaacccaagaagcgctgcctccttttgtag

DBGET integrated database retrieval system