Pimephales promelas (fathead minnow): 120489788 Help Entry 120489788         CDS       T08155                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism pprm  Pimephales promelas (fathead minnow) Pathway pprm04010   MAPK signaling pathway pprm04137   Mitophagy - animal pprm04140   Autophagy - animal pprm04218   Cellular senescence pprm04371   Apelin signaling pathway pprm04625   C-type lectin receptor signaling pathway pprm04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pprm00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120489788 (rras)    04371 Apelin signaling pathway     120489788 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120489788 (rras)    04137 Mitophagy - animal     120489788 (rras)   09143 Cell growth and death    04218 Cellular senescence     120489788 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120489788 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120489788 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pprm04147]     120489788 (rras)    04031 GTP-binding proteins [BR:pprm04031]     120489788 (rras) Exosome [BR:pprm04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120489788 (rras)   Exosomal proteins of bladder cancer cells    120489788 (rras) GTP-binding proteins [BR:pprm04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120489788 (rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase Motif Other DBs NCBI-GeneID:  120489788 NCBI-ProteinID:  XP_039542829 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MSTEERYKLVVVGGGGVGKSALSIQFIQSYFVSDYDPTIEDSYTKTCTVDGKETRLDILD TAGQEEFGAMREQYMRSGEGFLLVFALNDRGSFKEIQKFHTQILRVKDRDDFPIVLVGNK SDLDQQREISREEAMSFARENRIPYMESSAKNRHNVEEAFMEVVRAIRKFQETESPPLPA NHARKQKSGGCPCTLL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgtcaacggaagaaagatataagttggtggtcgtgggcggtggaggtgtggggaaaagc gccctcagtattcagttcattcagtcgtactttgtgtctgactatgacccgaccattgaa gactcgtacactaaaacctgcaccgtggatggaaaggagacacgattagacatcctggac acagcaggacaagaagagtttggagcgatgagagagcagtacatgcgctctggagagggt ttcttactggtgtttgctcttaatgaccgtggcagttttaaagaaattcagaaatttcac actcaaatattacgggtgaaggatcgagatgactttcccatagttcttgttggcaacaaa tcagatcttgaccagcagagagagatctcgagagaggaggccatgtcgtttgcccgagaa aacaggatcccctatatggaatcatcagctaagaaccgccacaatgtggaagaagccttc atggaggttgtgcgagcaataaggaagtttcaagagacggagagtccgccactccccgct aatcacgcgagaaagcagaagagtggtggctgtccctgcaccctgctctga

DBGET integrated database retrieval system